- CLK3 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-91794
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- PHCLK3, PHCLK3/152
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: RHRRRSRERG PYRTRKHAHH CHKRRTRSCS SASSRSQQSS KRSSRSVEDD KE
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Human
- CLK3
- Rabbit
- CDC like kinase 3
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Protein Kinase
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
RHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDDKE
Specifications/Features
Available conjugates: Unconjugated